Protein Info for Echvi_2341 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: naphthoate synthase (dihydroxynaphthoic acid synthetase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 TIGR01929: naphthoate synthase" amino acids 9 to 271 (263 residues), 410.2 bits, see alignment E=1.9e-127 PF00378: ECH_1" amino acids 18 to 272 (255 residues), 211 bits, see alignment E=1.9e-66 PF16113: ECH_2" amino acids 21 to 205 (185 residues), 47.4 bits, see alignment E=2e-16

Best Hits

Swiss-Prot: 54% identical to MENB_BACSU: 1,4-dihydroxy-2-naphthoyl-CoA synthase (menB) from Bacillus subtilis (strain 168)

KEGG orthology group: K01661, naphthoate synthase [EC: 4.1.3.36] (inferred from 91% identity to cly:Celly_2932)

MetaCyc: 60% identical to naphthoyl-CoA synthase (Synechocystis sp. PCC 6803)
Naphthoate synthase. [EC: 4.1.3.36]

Predicted SEED Role

"Naphthoate synthase (EC 4.1.3.36)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.1.3.36)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXH3 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Echvi_2341 naphthoate synthase (dihydroxynaphthoic acid synthetase) (Echinicola vietnamensis KMM 6221, DSM 17526)
MEWKVVKEFKDITYKKCDGVARIAFNRPEVRNAFRPQTTSELFEAFVDAREDTSIGVVLL
SAEGPSPKDGVYSFCSGGDQKARGHQGYVGDDGMHRLNILEVQRLIRFMPKVVIAVVPGW
AVGGGHSLHVVCDLTLASKEHAIFKQTDADVTSFDGGYGSAYLAKMVGQKRAREIFFLGR
NYSAQEAYEMGMVNAVIPHNELEDTAYEWAQEILAKSPTSIKMLKFAFNLTDDGMVGQQV
FAGEATRLTYMTEEAQEGRNAFLEKRKPNFKDIKWIP