Protein Info for Echvi_2335 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF00132: Hexapep" amino acids 13 to 46 (34 residues), 28.2 bits, see alignment 5.6e-11 amino acids 73 to 105 (33 residues), 27.5 bits, see alignment 9.5e-11

Best Hits

Swiss-Prot: 41% identical to Y304_METJA: Uncharacterized protein MJ0304 (MJ0304) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 66% identity to dfe:Dfer_4073)

MetaCyc: 37% identical to 2-hydroxycyclohepta-1,4,6-triene-1-carboxyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-

Predicted SEED Role

"carbonic anhydrase, family 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZY7 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Echvi_2335 Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily (Echinicola vietnamensis KMM 6221, DSM 17526)
MALVKSVNGKVPVFGEKCWLADNATVVGDVRMGEGCTVWFNAVVRGDVHEIVIGNHTNIQ
DGAIIHCTYQKAGTYIGSNVSIAHNAIVHGCTVHDNVLIGMGAVVMDNAVVHSGAVVAAG
AIVLAGTVVEANSIYAGIPAKKVKDTGEEMMAVIKRTAENYPKYASWYEED