Protein Info for Echvi_2333 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Anthranilate/para-aminobenzoate synthases component I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04715: Anth_synt_I_N
  • amino acids 69 to 111 (43 residues), 26.4 bits, 7.2e-10
• PF00425: Chorismate_bind
  • amino acids 147 to 403 (257 residues), 278.7 bits, E=5.2e-87

Best Hits

KEGG orthology group: K01665, para-aminobenzoate synthetase component I [EC: 2.6.1.85] (inferred from 47% identity to phe:Phep_1201)

Predicted SEED Role

"Para-aminobenzoate synthase, aminase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 2.6.1.85)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (12/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (10/10 steps found)
• L-citrulline biosynthesis (8/8 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

See L0G0R5 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Echvi_2333 Anthranilate/para-aminobenzoate synthases component I (Echinicola vietnamensis KMM 6221, DSM 17526)
MKYANTGEFPLQKEWIEKALHWASNHFAYVSYHHHNDISYPHQGFTHVLFAGQHSVAWND
MDAHSGPKAGILSYDLKNKFERLKSQNPSLVNCPETCFFLPELTILFHEKTLEIKSAAPD
RLFEEIRDYQPEIVSQKIAPVQVKTSKSEYIQTVRNIQEHIRQGDIYEMNYCIAFEAVVE
SINPVQVFLDLEKKSPMPFASFFKCQDQYLVGASPERFIKKQGLQITAQPIKGTIQRGKT
AEEDANYRESLRLSEKEQAENLMIVDLMRNDLARIAETGSIKVEELFGIYPFRQVYQMIS
TVTATLRPGTSFTEIIANTFPMGSMTGAPKIKCMELIDRYENFKRGWFSGALGFVDEFGN
LDFSVVIRSIIIDTKSKHLFFAAGSAITFDADPAYEYEECLLKAKAIQETLRS