Protein Info for Echvi_2323 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: tRNA dimethylallyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR00174: tRNA dimethylallyltransferase" amino acids 10 to 290 (281 residues), 265.6 bits, see alignment E=2.5e-83 PF01745: IPT" amino acids 11 to 105 (95 residues), 38.6 bits, see alignment E=8.6e-14 PF01715: IPPT" amino acids 42 to 281 (240 residues), 270.2 bits, see alignment E=1.9e-84

Best Hits

Swiss-Prot: 51% identical to MIAA_CYTH3: tRNA dimethylallyltransferase (miaA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00791, tRNA dimethylallyltransferase [EC: 2.5.1.75] (inferred from 59% identity to mtt:Ftrac_0829)

Predicted SEED Role

"tRNA dimethylallyltransferase (EC 2.5.1.75)" (EC 2.5.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0Q6 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Echvi_2323 tRNA dimethylallyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MLVKNDKYLLVVAGPTAVGKTDLCIKLAKNFKTAIISSDSRQFYKETNIGTAKPSPAEMQ
DVPHYFVDNLSVYEDYDVRRFEKDALQVLEKLFETHDVVIMTGGSGLYIDAVCNGFDPIP
DIDPEIRKSLNQFYQENGIKALQDKLAALDPDYFKEVDIHNPQRLIRGCEVTLGTGKPFS
SYRNRGHAKRPFQVIKIGLWREREELYDRINMRMDAMIASGLFEEAERLFPLRSLNALQT
VGYTEIFGYLEGNYDKEEAIRLLKRNSRRYAKRQMTWFRRDEEMKWFSPDEYEQVVTYVE
GQMGP