Protein Info for Echvi_2319 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Metal-dependent hydrolases of the beta-lactamase superfamily I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details PF23023: Anti-Pycsar_Apyc1" amino acids 32 to 230 (199 residues), 36.7 bits, see alignment E=6e-13 PF00753: Lactamase_B" amino acids 41 to 223 (183 residues), 40.1 bits, see alignment E=6e-14 PF12706: Lactamase_B_2" amino acids 47 to 224 (178 residues), 124.7 bits, see alignment E=5.8e-40

Best Hits

KEGG orthology group: K06167, PhnP protein (inferred from 62% identity to sli:Slin_3277)

Predicted SEED Role

"Metal-dependent hydrolases of the beta-lactamase superfamily I; PhnP protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZ54 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Echvi_2319 Metal-dependent hydrolases of the beta-lactamase superfamily I (Echinicola vietnamensis KMM 6221, DSM 17526)
MKVTFLGTGTSQGIPVIGCKCETCSSIDFRDKRLRSSIHLKVDDNSFVIDTGPDFRAQML
REGINELDAIIYTHEHKDHTAGMDDIRPFNFMQMRDMPLYGTPAVLNQLQREYSYVFAPK
KYPGVPQVVTHEISNQPFEVLGTTFTPILVMHYKLPVFGYRIKDFTYITDAKYIAEEELD
KVRGTKILVLNALQIKEHLSHLTLSEALELIDIIKPEKAYLTHISHKLGTQQNVESKLPD
NVFLAYDGLTISL