Protein Info for Echvi_2304 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type multidrug transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF00005: ABC_tran" amino acids 22 to 161 (140 residues), 66.7 bits, see alignment E=3.6e-22 PF13304: AAA_21" amino acids 90 to 194 (105 residues), 33.2 bits, see alignment E=5.5e-12

Best Hits

KEGG orthology group: K01990, ABC-2 type transport system ATP-binding protein (inferred from 74% identity to rbi:RB2501_06590)

Predicted SEED Role

"ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZ42 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Echvi_2304 ABC-type multidrug transport system, ATPase component (Echinicola vietnamensis KMM 6221, DSM 17526)
MIKIENLSKRYAEDSVLDIDALEIPAGEIFGLVGNNGAGKTTLFSLLLDLIMPTTGKVLN
HEVQVNISEDWKPYTAAFIDESFLIGYLTPEEYFYFIGELRGMNKQDVSEFLLPFEDFFH
GEILGGKKYLRDLSKGNQKKVGIIASFLGRPKVIILDEPFANLDPTTQIRLKKIIAQYKD
DPEVTLLISSHDLLHVTEVCQRIVVLNKGKVVRDTKTSDATLRELESFFAEEIQSAEGE