Protein Info for Echvi_2303 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 23 to 50 (28 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 373 to 398 (26 residues), see Phobius details amino acids 419 to 439 (21 residues), see Phobius details amino acids 445 to 462 (18 residues), see Phobius details PF18940: DUF5687" amino acids 9 to 488 (480 residues), 661.3 bits, see alignment E=7e-203

Best Hits

KEGG orthology group: None (inferred from 60% identity to rbi:RB2501_06595)

Predicted SEED Role

"FIG00651924: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0P0 at UniProt or InterPro

Protein Sequence (489 amino acids)

>Echvi_2303 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MIKHLVILQWKSFFRSAAFSSNLAIKILMGFAALYMMLSFGFMGVATFYMLEKMELNAFE
TVNRFMVYYLVFDLVVRYMLQKMPVVQIKPMLFLPIKKSTIVQYSIWKTILSFFNIIHAF
FFIPFAVVLVINGYEAVPVLLWMVGIYALLLANNFINIFLNGVDAVLFSVLGLLASLGLI
QYYGVFDLSIYTGPVFQSFYDLPLLAFIPVLFMLTVYWVAFKYFRERLYLDAGLSSKVKE
AKSENLAWLDRFGSIAVFLKNDIKLIKRNKRSKTTVLMSVMFLFYGLLFFTNSIEAYQGP
AWRIFAALFVTGGFLFSFGQYVPSWDSSYYPLMMSQNIRYRDYLNAKWWLMVIATVVSTI
LASFYAYFGWEVYLAILVAGIYNIGVNSYMVLWGGVYVRTPIDLSSNKGALGSSQAFNAK
TLLLTIPKLLLPMVLYVIGHFTVGPYLGYLLVAISAILGFAFKEKVFNLIEKNYKTEKYK
TLAAYKQKS