Protein Info for Echvi_2295 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: YeeE/YedE family (DUF395).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details PF20398: DUF6691" amino acids 12 to 137 (126 residues), 33.6 bits, see alignment E=4.6e-12 PF04143: Sulf_transp" amino acids 37 to 138 (102 residues), 37.3 bits, see alignment E=2.4e-13

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 69% identity to fjo:Fjoh_4883)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZV7 at UniProt or InterPro

Protein Sequence (145 amino acids)

>Echvi_2295 YeeE/YedE family (DUF395). (Echinicola vietnamensis KMM 6221, DSM 17526)
MSAKKTERGLALLKYLFVGMFFGIVLVKAEVISWFRIQEMFRLQSFHMYGVIGAAVAVGM
LSVFLIKKFDIKTISGEKVVIKDKEFKKGQIFGGFIFGLGWAVTGACPGPIFAQIGIGYS
VVIVTFISAVAGTWVYGKLADKLPN