Protein Info for Echvi_2292 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 6 to 38 (33 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 101 to 131 (31 residues), see Phobius details amino acids 151 to 180 (30 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details PF01925: TauE" amino acids 9 to 258 (250 residues), 133.9 bits, see alignment E=3.9e-43

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 61% identity to cat:CA2559_11828)

Predicted SEED Role

"FIG00693269: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G142 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Echvi_2292 Predicted permeases (Echinicola vietnamensis KMM 6221, DSM 17526)
MEINSLIGFGGAILIGISLGMIGGGGSILTVPILVYLLGIEPVLATAYSLFVVGSTSLVG
AGSYLKRGKVSYRIALVFALPSFLAIFLMRKYVVHALPEVLFALGGFTVSKNLAIMVFFA
AIMLLAAYSMIKNGTKLTPDSKAKTLNYPLIALQGLVEGSITGIVGAGGGFLIIPALVLI
AKLPMRMAVGTSLLIIGIKSLLGFTGDLISQDIDWSFLLIFTGLSIVGIFMGGKLSRKVN
ESALKKAFGWFVLLMGGYILIRELAFG