Protein Info for Echvi_2273 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Inorganic pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00719: Pyrophosphatase
  • amino acids 21 to 171 (151 residues), 199.4 bits, E=1.4e-63

Best Hits

Swiss-Prot: 61% identical to IPYR_LEPIN: Inorganic pyrophosphatase (ppa) from Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)

KEGG orthology group: K01507, inorganic pyrophosphatase [EC: 3.6.1.1] (inferred from 70% identity to mtt:Ftrac_2800)

Predicted SEED Role

"Inorganic pyrophosphatase (EC 3.6.1.1)" in subsystem Phosphate metabolism (EC 3.6.1.1)

MetaCyc Pathways

• glyphosate degradation III (1/7 steps found)
• (aminomethyl)phosphonate degradation (1/8 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.1

Use Curated BLAST to search for 3.6.1.1

Sequence Analysis Tools

See L0G0L3 at UniProt or InterPro

Protein Sequence (179 amino acids)

>Echvi_2273 Inorganic pyrophosphatase (Echinicola vietnamensis KMM 6221, DSM 17526)
MINPWHDVQIGEEAPEYVQGIIEIPKGSKGKYELDKKTGMLMLDRVLFSAVHYPANYGFI
PQTFCEDHDPLDILIMSQIDIPSMTLVKAKVIGVMRMVDGGEADDKIIAVAADDQSVNYI
NDIDELPPYLMKEIHRFFEDYKKLENKEVKVEDFLGKEDAMRIVNESIELYDKNFRTKK