Protein Info for Echvi_2263 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: HD superfamily phosphohydrolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details PF19276: HD_assoc_2" amino acids 182 to 239 (58 residues), 37.6 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: K06885, (no description) (inferred from 58% identity to sli:Slin_6492)

Predicted SEED Role

"Deoxyguanosinetriphosphate triphosphohydrolase (EC 3.1.5.1)" in subsystem Purine conversions (EC 3.1.5.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.5.1

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0K4 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Echvi_2263 HD superfamily phosphohydrolases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKSHKILNDPVYGFITIPSELIFTIIDHPFFQRLRRIKQLGLTDLVYPGALHTRFHHAIG
AMHLMSITLDNLRNKGHEISDHEYEASLIAILLHDIGHGPFSHALEYTLLKGIPHESLSL
LLMESLNNQLNGQLDLALRIFKNKYERKFFHQLVSSQLDIDRLDYLQRDCFFTGVSEGTI
GADRIIKMMNIKDDQIVVEEKGLYSIENFLSARRLMYWQVYLHKTTVSAEKMLINLITRA
KDLQQSGVDVEGSHAFRHLLQNNYTLRDFQQSPALLETFADLDDFDIWGAIKYWKNHDDF
VLRSISEMFLTRNLFKIKLSNLPFEETQLELMNKEVAKGLNLPDEALPYFVSSGFISNNA
YVAKEKVMILTKKGEVIDVAQAADLPNIKAMSKIVKKYYACRAKNLTLR