Protein Info for Echvi_2252 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Mg-chelatase subunit ChlD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details PF01882: DUF58" amino acids 105 to 216 (112 residues), 28.9 bits, see alignment E=1.1e-10 PF00092: VWA" amino acids 109 to 299 (191 residues), 78.6 bits, see alignment E=1e-25 PF13519: VWA_2" amino acids 110 to 217 (108 residues), 62 bits, see alignment E=1.1e-20

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 44% identity to pdi:BDI_0948)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G110 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Echvi_2252 Mg-chelatase subunit ChlD (Echinicola vietnamensis KMM 6221, DSM 17526)
MSANSIIEWFSWSWFLPETFRSYEWKNPWVLHLLWIVPLILLIRKFTKLLKNPSLELSLP
GSVSSSNPWTYLRLVPTLFFMLALGMVIIALARPQRSNEKVEQSTEGIDIMLVLDISESM
DLQDFEPNRLEAAKSTAIDFINGRFGDRIGMVIFAGEAFSLAPLTTDYELLTDLIDDISF
DMMDAKGTAIGSAVATATNRMRESDSKSKVMVLLSDGDNNAGNVDPTFAAELAEAMDIKI
YTIAVGKDGMVPYGTDFFGRPQMVESYLNETTLRDLARIGKGQFFRASDDKALENIFEQI
DQLEKAEILESRYKETQDYYRPYLFLGIFFFFIWLGLKSSFMNNFLLD