Protein Info for Echvi_2220 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): pif1-like DNA repair helicase
Rationale: Specifically important in stress Cisplatin; stress Nalidixic acid sodium salt; stress Lomefloxacin hydrochloride. Contains a pif1-like helicase domain and probably part of the RecD superfamily (see CDD). (SEED_correct)
Original annotation: PIF1 helicase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 PF13245: AAA_19" amino acids 45 to 177 (133 residues), 74 bits, see alignment E=2.7e-24 PF05970: PIF1" amino acids 47 to 211 (165 residues), 37.6 bits, see alignment E=3.7e-13 PF13604: AAA_30" amino acids 48 to 225 (178 residues), 79.3 bits, see alignment E=6.6e-26 PF13538: UvrD_C_2" amino acids 415 to 466 (52 residues), 70.5 bits, see alignment 1.7e-23

Best Hits

KEGG orthology group: K01144, exodeoxyribonuclease V [EC: 3.1.11.5] (inferred from 59% identity to mtt:Ftrac_0889)

Predicted SEED Role

"RecD-like DNA helicase Atu2026"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0U7 at UniProt or InterPro

Protein Sequence (475 amino acids)

>Echvi_2220 pif1-like DNA repair helicase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKDKQDIPNPSALIRQNFPYEPTHGQGSFFRLMNTFLDEDFDRKPTFVLRGYAGTGKTS
VIAAVVKSLPKLNFRSLLLAPTGRAAKVMAAYSGRMGFTIHKIIYRPKDQEGMAGSGFDL
QKNYYKNTVFIVDEASMLSDDALGGSNLLRDLLQYVFQHPSNRLILIGDTAQLPPVGSEN
SPALDGNYLVHHYGLDVLEAELTEVMRQQLDSGILYNATELRKEVVKEAPVISFRIKGFP
DFYKMTSERLEDGLRYAYDKYGVENTIIITRSNKTAVQYNQYIRRTIHFYEEEISAGDML
MIVRNNYTYMAESDKVSFLANGDFVEVVKIRSFEEMYGLRFATLELRLIDYPEEPFFEAK
VILDTLYTSSTSLSTEDAKELYRQVTEDYAGVENKKERREYIKKDPYLNALQVKFAYALT
CHKSQGGQWSAVFVDQGYVSEDQLDTAYIRWLYTALTRATAEVFLVNFHANFFVG