Protein Info for Echvi_2214 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: orotate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR00336: orotate phosphoribosyltransferase" amino acids 16 to 182 (167 residues), 140.3 bits, see alignment E=2.8e-45 PF00156: Pribosyltran" amino acids 75 to 157 (83 residues), 35.3 bits, see alignment E=3.5e-13

Best Hits

Swiss-Prot: 64% identical to PYRE_CYTH3: Orotate phosphoribosyltransferase (pyrE) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 64% identity to mtt:Ftrac_1363)

MetaCyc: 53% identical to orotate phosphoribosyltransferase (Bacillus subtilis subtilis 168)
Orotate phosphoribosyltransferase. [EC: 2.4.2.10]

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FX40 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Echvi_2214 orotate phosphoribosyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MELHSKEIAAAVARKLLDIKAIRLQPKQPFTWASGWKSPIYCDNRLSLSFPEARTFIKEK
LVEVIKKHFPNAEGIAGVATAGIPQGALIAEEMGLPFIYVRSKPKGHGMENMIEGKVTKG
QKVVVIEDLVSTGGSSLKAVEALKASGFDVLGMAAIFTYGFEIARQNFENAELKLICLSD
YEAMLPQAIENNYASDEDLQSLAEWRKSPDTWEKE