Protein Info for Echvi_2200 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: peptide chain release factor 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR00020: peptide chain release factor 2" amino acids 3 to 357 (355 residues), 443.3 bits, see alignment E=3.2e-137 PF03462: PCRF" amino acids 26 to 213 (188 residues), 183.2 bits, see alignment E=5.2e-58 PF00472: RF-1" amino acids 222 to 331 (110 residues), 134.3 bits, see alignment E=1.9e-43

Best Hits

Swiss-Prot: 50% identical to RF2_LACLM: Peptide chain release factor 2 (prfB) from Lactococcus lactis subsp. cremoris (strain MG1363)

KEGG orthology group: K02836, peptide chain release factor 2 (inferred from 75% identity to mtt:Ftrac_0938)

Predicted SEED Role

"Peptide chain release factor 2; programmed frameshift-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0S3 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Echvi_2200 peptide chain release factor 2 (Echinicola vietnamensis KMM 6221, DSM 17526)
MTSEQLKDLKARITALRRYLDYDRKKAEIEDLEAVSAQPDFWNNPEEAEKTMKQIQARKG
WTGAYESAEAKVQDLEVLYEFYTAGDVEEEEIKTDYQKALNEIEELELKKMLSSEEDQLS
ALMEINPGAGGTESNDWASILMRMYIMWGEKNGYKVKEVDLQEGDVAGIKSVTLEFDGPL
AYGFLKSEIGVHRLVRISPFDSGGRRHTSFASVYVYPVVDDSIEIEINPSDIELQTSRSG
GAGGQNVNKVETKVQLTHKPTGIVVVCQVERSQLANREKAMQMLKSRLYQMEMEKRNAER
DKIEAGKMKIDFGSQIRNYVLHPYKLVKDARTSHETSDVQTVLDGGLNDFIKAYLLAQSE
EEAENN