Protein Info for Echvi_2168 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RNA polymerase sigma-70 factor, Bacteroides expansion family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 186 to 203 (18 residues), see Phobius details PF07638: Sigma70_ECF" amino acids 19 to 183 (165 residues), 34.8 bits, see alignment E=3.2e-12 TIGR02985: RNA polymerase sigma-70 factor, Bacteroides expansion family 1" amino acids 29 to 186 (158 residues), 155.2 bits, see alignment E=1.8e-49 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 30 to 185 (156 residues), 93 bits, see alignment E=1.5e-30 PF04542: Sigma70_r2" amino acids 34 to 98 (65 residues), 54.6 bits, see alignment E=1.6e-18 PF08281: Sigma70_r4_2" amino acids 133 to 180 (48 residues), 54.1 bits, see alignment E=2e-18 PF04545: Sigma70_r4" amino acids 136 to 171 (36 residues), 26.8 bits, see alignment 6.1e-10

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 35% identity to phe:Phep_0708)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWY5 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Echvi_2168 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (Echinicola vietnamensis KMM 6221, DSM 17526)
MFKKYLFMRKLIKYTEKRLVALVREGDLNAFDELYHRYAPRVYGFAKRVFHDKDVAEEAV
QVVFVKLWEKRKGLNEQLNFKSYLFTAVKHQVYNRLREVKNTVDLEEMVTDHTYQGVSGL
EVLEYKEFEESALGLIERLPNVQQKVFKLSRLEGVSHKEIAEKLGLSVRTVEHHCYLATK
FLKGQLLKQASVATLIFCFLNLLQ