Protein Info for Echvi_2131 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 3-deoxy-8-phosphooctulonate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF00793: DAHP_synth_1" amino acids 11 to 270 (260 residues), 230.8 bits, see alignment E=7.4e-73 TIGR01362: 3-deoxy-8-phosphooctulonate synthase" amino acids 20 to 269 (250 residues), 375.4 bits, see alignment E=5.8e-117

Best Hits

Swiss-Prot: 60% identical to KDSA_ACAM1: 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA) from Acaryochloris marina (strain MBIC 11017)

KEGG orthology group: K01627, 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC: 2.5.1.55] (inferred from 58% identity to hya:HY04AAS1_1603)

MetaCyc: 50% identical to 3-deoxy-8-phosphooctulonate synthase subunit (Arabidopsis thaliana col)
3-deoxy-8-phosphooctulonate synthase. [EC: 2.5.1.55]

Predicted SEED Role

"2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase (EC 2.5.1.55)" in subsystem KDO2-Lipid A biosynthesis (EC 2.5.1.55)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYK7 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Echvi_2131 3-deoxy-8-phosphooctulonate synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MPVFTQPMHVTDQVVLGKEKPVLFSGPCAVESFDICMEIGSTVKEQAAKNGFSYVFKASF
DKANRTSSGSFRGIGMDKSLEVLQRVGKELGVPLVTDIHESYQAAEVAEVADVLQIPAFL
CRQTDLLLAAGNTGKAIKIKRGQFMAPEDMQYAVNKVRSTGNQNVCLTERGFSLGYHNLV
VDMRSLPTMRQFAPVVFDITHSVQQPGGQGGSSGGQRQFAPFLARAAAATGVDGFFIETH
PEPAKALSDGPNMVPLDRMAGFLEMLKESWELGRKHAGFAIG