Protein Info for Echvi_2108 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted small integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details PF03626: COX4_pro" amino acids 24 to 95 (72 residues), 54.1 bits, see alignment E=8.4e-19

Best Hits

KEGG orthology group: None (inferred from 53% identity to mtt:Ftrac_3698)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWS2 at UniProt or InterPro

Protein Sequence (109 amino acids)

>Echvi_2108 Predicted small integral membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MSAHGNNSTLEVLPRNKEKIRKIWKTAGILLAITAVEFLLAFTMERGMLLFAIFIGLTLV
KAAYIMMEFMHLKDESKTLFWSIMLPLIFLVWLLIALFKEGAEIFIYRW