Protein Info for Echvi_2101 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 363 to 381 (19 residues), see Phobius details amino acids 389 to 407 (19 residues), see Phobius details amino acids 423 to 445 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 54% identity to mtt:Ftrac_3691)

Predicted SEED Role

"Putative uncharacterized protein TTHA1760"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYH7 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Echvi_2101 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MAHVTNFNLDQKFDFTAALKKTIFIMGGIGLLLLVIGIFTNGSGDHGHESSGHQTEHVEA
TGHGDDHHAEAAAGHGEHEEHAAEAGHEEGGHGSGATFKRFFANLWVNNVYFAGLAIIGV
FFFAIQYAAQAGWATAILRVMISFGNWLPFAAIAMIATYFIAGHDLFHWTHSDLFDPESS
HYDKIIDGKGGFFYWPLAKGSFPIFWLIRMVAFFGLWIFFFNKLKNLSLQEDINGGDSYW
YKMRKFSAIFLVIFAVSSSISAWDWVMSIDTHWFSTLFGWYVFSSWFVAGLSAICLVTIM
LKERGYLEMFNENHLHDLGKFIFGFSIFWTYLWFSQFLLIYYANIPEESVYYIERLTSDK
YSGFFFANLILNFVIPFLVLMTRDSKRHFIFLKVVCTIIIIGHWLDFSLMVQPGTLGHNG
GIGLMEIGMFLCYASVVIFVVLTGLSKKNLIAKHHPMLEETYHHHI