Protein Info for Echvi_2098 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Polysulphide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 36 to 60 (25 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 342 to 360 (19 residues), see Phobius details amino acids 367 to 392 (26 residues), see Phobius details amino acids 413 to 433 (21 residues), see Phobius details PF03916: NrfD" amino acids 69 to 393 (325 residues), 70.5 bits, see alignment E=9.8e-24

Best Hits

KEGG orthology group: K00185, molybdopterin oxidoreductase, membrane subunit [EC: 1.2.7.-] (inferred from 81% identity to mtt:Ftrac_3688)

Predicted SEED Role

"Molybdopterin oxidoreductase (EC 1.2.7.-)" (EC 1.2.7.-)

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.-

Use Curated BLAST to search for 1.2.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWR1 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Echvi_2098 Polysulphide reductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MQVTSSVREPLVTGGKTYKDVTHDVSRQVEGKPTIGWMLGLAVSIGVLLLGGIAVGATVW
EGIGMWGLNKTVGWAWDITNFVWWVGIGHAGTLISAVLLLFRQKWRTSINRAAEAMTIFA
VICAAMFPVLHMGRPWLGAYWALPLPNVFGSLWVNFNSPLLWDVFAISTYFSVSLVFWYI
GLIPDFATIRDRATGLRKVVYGALSFGWTGAAKIWMRYEAVSLILAGLATPLVLSVHTIV
SFDFATSVIPGWHTTIFPPYFVAGAIFSGFAMVLTLMLITRKLFKLEDYITMVHIELMNI
VIIITGSIVGIAYITEFFIAWYSGVAAEQYAFINRAFGPYWWAYWSMMTCNVISPQLFWF
KKIRTSIVFTFALSIVVNIGMWFERFVIIVTSLHRDFLPSSWAMFYPTWADVGVYLFTFG
LFFTLFLLFAKFFPVINMAEVKSVLKSSSEKVNK