Protein Info for Echvi_2092 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Zn-dependent dipeptidase, microsomal dipeptidase homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF01244: Peptidase_M19" amino acids 3 to 350 (348 residues), 157 bits, see alignment E=3.4e-50

Best Hits

KEGG orthology group: K01273, membrane dipeptidase [EC: 3.4.13.19] (inferred from 76% identity to cpi:Cpin_6999)

Predicted SEED Role

"Membrane dipeptidase (EC 3.4.13.19)" (EC 3.4.13.19)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.13.19

Use Curated BLAST to search for 3.4.13.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWQ6 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Echvi_2092 Zn-dependent dipeptidase, microsomal dipeptidase homolog (Echinicola vietnamensis KMM 6221, DSM 17526)
MFTIDAHLDLSMNALEWNRDLTQPVTGINAREKGMTDKPDRGKATVSLPALRAGNIGLVV
ATQIARYVAPDNSLPGWHSPAQAWAQTQGQLAWYKAMEDAGEMVQITDLDSLEKHLDDWH
WGGDKLPIGYILSLEGADSMVDLGYLEKAYAYGLRALGPAHYGPGRYAQGTDATGFMGRR
GQDLLKEMERLNIILDATHLCDDSFWEAMDHFEGAVWASHNNCRALVDHNRQFSDEQLKE
LIARDAVIGGALDAWMMVPGWVRGESTPEGMGCNLEKMIDHLDHICQLAGNADHIGIGSD
LDGAFGKEQCPYDLETIADLTSVPDLLRKRGYKESEVEKVMHGNWLRFLRNVWG