Protein Info for Echvi_2089 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: gluconate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 96 to 125 (30 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 174 to 197 (24 residues), see Phobius details amino acids 218 to 242 (25 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details amino acids 337 to 365 (29 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details amino acids 414 to 437 (24 residues), see Phobius details TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 1 to 437 (437 residues), 508.5 bits, see alignment E=8.7e-157 PF02447: GntP_permease" amino acids 1 to 434 (434 residues), 501 bits, see alignment E=5.7e-154 PF03600: CitMHS" amino acids 15 to 383 (369 residues), 74.3 bits, see alignment E=2.1e-24 PF06808: DctM" amino acids 213 to 381 (169 residues), 26.4 bits, see alignment E=6.4e-10 PF03553: Na_H_antiporter" amino acids 262 to 392 (131 residues), 24.5 bits, see alignment E=3e-09

Best Hits

KEGG orthology group: K06155, Gnt-I system high-affinity gluconate transporter (inferred from 58% identity to cpi:Cpin_7002)

Predicted SEED Role

"Gluconate permease, Bsu4004 homolog" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G001 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Echvi_2089 gluconate transporter (Echinicola vietnamensis KMM 6221, DSM 17526)
MTILFVLLSILLLVLLIVWAKLNPFIAFLITSIVAGLLLGIPPEQVAVSVQQGMGSLLGD
LVIIITMGAMLGKLVAESGAAQRIADFLMRVFGKKYIHWAMMVTGLVVGIPLFYNVGFVL
LVPLVFTVAHQYKLSAVYVGIPLLAALSVTHGFLPPHPSPAALVAQFDANMGVTLLYGMM
VAIPTILVAGPFFARFLKHIPASPLKSFRASSKPEEELPGTINSFLSALLPVVLLVGTPV
LLMQTDEQSALYGYVKFIADPGMVMLFSLLVATFTLGLHQGMKMDHLMDIYVDSVKDVAM
IILIVAGAGALKQVLLDSGVSQVIADGLEGWNVHPLVLAWTITAVIRVCVGSATVAGLTT
AGIIAPLIEGSGVDPNLVVLAIGAGSLMFSHFNDAGFWMYKEFFNVSIKDTIRSWSVMET
IVAVVGLAGVMVLDWVVG