Protein Info for Echvi_2088 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Restriction endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF14279: HNH_5" amino acids 84 to 133 (50 residues), 56.7 bits, see alignment E=2.9e-19 PF01844: HNH" amino acids 84 to 126 (43 residues), 59.5 bits, see alignment E=4.2e-20 PF13395: HNH_4" amino acids 91 to 128 (38 residues), 27 bits, see alignment 5.5e-10

Best Hits

KEGG orthology group: None (inferred from 50% identity to mtt:Ftrac_0060)

Predicted SEED Role

"HNH endonuclease family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0D9 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Echvi_2088 Restriction endonuclease (Echinicola vietnamensis KMM 6221, DSM 17526)
MEKKVLVLNLDHTPIAVVNVQKAMVLTLLEKVSVLADYPFLSIRTIDREFSYPAVVRLDE
YKNVPYRGVLLTRSNLFKRDDNECQYCGSPKHLTVDHVIPRSKGGKSSWTNLITACHRCN
VLKGDKTPEEVGMLMRKKPFKPTLAYFLAEYAERNAEEWIPFLSAKAVQPG