Protein Info for Echvi_2067 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: DNA repair protein RecN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 PF02463: SMC_N" amino acids 1 to 507 (507 residues), 58.9 bits, see alignment E=7.9e-20 TIGR00634: DNA repair protein RecN" amino acids 1 to 548 (548 residues), 474.6 bits, see alignment E=2.9e-146 PF13476: AAA_23" amino acids 5 to 230 (226 residues), 44.3 bits, see alignment E=5e-15

Best Hits

KEGG orthology group: K03631, DNA repair protein RecN (Recombination protein N) (inferred from 52% identity to lby:Lbys_1436)

Predicted SEED Role

"DNA repair protein RecN" in subsystem DNA-replication or DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWN1 at UniProt or InterPro

Protein Sequence (550 amino acids)

>Echvi_2067 DNA repair protein RecN (Echinicola vietnamensis KMM 6221, DSM 17526)
MLKNLSITNYALIETLEMGPSKGLNMITGETGAGKSIMLGAIGLLLGNRADTKALFNDEK
KCIIEGVFEIANYGLEAYFQAEDLDYDPQCIIRREITPAGKSRAFVNDTPVKLDILKSLG
KALMDIHSQHDTLLLAAGEYQLSLIDAFADTKTEKTQYSTAYTAYRKAKKSYEKLVHEAA
ELRKEADFNQFQLEELSALQLQEGEQETLENEQEVLDNAEEIKSKINENLQLFNGDELGA
TTLLMQINQGFQQLGRYSSRFDELKERFDSVCIEVNDIAASLEDEDGKIEVDFDKLEEIR
ERLSKIYQLQKKHGVQTVEELIALEKTLADKAFQIGNLDEELEQLKAEMDQTWEILSQTG
AKLSQKRQRHFKGFAEEITGLLAHLGMENANIEISHRTTDPTPSGKDEVEILFTANKGVK
PQPIRQVASGGEFSRLMFAIKYIMADKVALPTLIFDEIDTGISGEVALQMVQMMQEIAKR
HQVICISHLPQVAAKGEKHYFVYKDNSAAKTMSKIRALNQEERVTEIAKMIAGANPSESA
VKSAMDLLGK