Protein Info for Echvi_2058 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ketol-acid reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF07991: KARI_N" amino acids 26 to 192 (167 residues), 146.7 bits, see alignment E=4.8e-47 TIGR00465: ketol-acid reductoisomerase" amino acids 27 to 346 (320 residues), 314.6 bits, see alignment E=3e-98 PF01450: KARI_C" amino acids 200 to 344 (145 residues), 140.7 bits, see alignment E=4.5e-45

Best Hits

Swiss-Prot: 70% identical to ILVC_DESOH: Ketol-acid reductoisomerase (NAD(+)) (Dole_2039) from Desulfococcus oleovorans (strain DSM 6200 / Hxd3)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 86% identity to cpi:Cpin_1923)

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0A8 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Echvi_2058 ketol-acid reductoisomerase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKLKFGTVEEDVVTREEFPLEKAREVLKDEVIAVLGYGVQGPGQALNLKDNGFNVIVGQR
KNSKTWDKAVADGWVPGETLFELEEACEKGTILQFLLSDAGQIALWPTVKKHLTPGKALY
FSHGFGVTYKDQTGIVPPEDVDVILVAPKGSGTSLRRMFVEGRGLNSSFAIYQDATGKAR
ERVIALGIGVGSGYLFETDFYREVTSDLTGERGTLMGAIQGIFAAQYEVLRENGHSPSEA
FNETVEELTQSLMPLVAENGMDWMYANCSTTAQRGALDWWKPFRDASKPVFEQLYKSVKD
GKEAAKSIESNSKADYREKLEVELKELRESEMWKAGATVRKLRPENN