Protein Info for Echvi_2057 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): acetohydroxybutanoate synthase regulatory subunit (EC 2.2.1.6)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00119.
Original annotation: acetolactate synthase, small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00119: acetolactate synthase, small subunit
  • amino acids 3 to 156 (154 residues), 110.5 bits, E=3.7e-36
• PF01842: ACT
  • amino acids 4 to 69 (66 residues), 31.9 bits, E=1.4e-11
• PF13710: ACT_5
  • amino acids 15 to 73 (59 residues), 41.7 bits, E=1.2e-14
• PF10369: ALS_ss_C
  • amino acids 85 to 156 (72 residues), 68.2 bits, E=8.7e-23

Best Hits

Swiss-Prot: 32% identical to ILVH_SYNY3: Acetolactate synthase small subunit (ilvH) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 55% identity to wvi:Weevi_0073)

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• L-isoleucine biosynthesis II (6/8 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• pyruvate fermentation to (S)-acetoin (2/3 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• L-isoleucine biosynthesis IV (3/6 steps found)
• superpathway of (R,R)-butanediol biosynthesis (2/5 steps found)
• superpathway of L-threonine metabolism (11/18 steps found)
• superpathway of 2,3-butanediol biosynthesis (2/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

See L0FWM1 at UniProt or InterPro

Protein Sequence (167 amino acids)

>Echvi_2057 acetohydroxybutanoate synthase regulatory subunit  (EC 2.2.1.6) (Echinicola vietnamensis KMM 6221, DSM 17526)
MNRYTVSLFTENFIGILNRVTLIFTRRGVNIDALTASESKEDGVHRITIEVTTTEDQVIQ
IVKQTEKIIDVIKSFYYKDDEVVYQEIALYKIPISSLDPGLEKVIRQYNARIISAEKEFV
VIEMTGHKEDTKALLEILKDFNILEFARSGRVAVAKPMGTIEQYLNN