Protein Info for Echvi_2051 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details PF00892: EamA" amino acids 9 to 137 (129 residues), 40.3 bits, see alignment E=1.9e-14 amino acids 145 to 286 (142 residues), 47.4 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: None (inferred from 33% identity to bsa:Bacsa_1559)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZ22 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Echvi_2051 Predicted permeases (Echinicola vietnamensis KMM 6221, DSM 17526)
MTGASFKDYLMLHLTVLIWGFTAILGLLIVIPAVEIVFYRTLLASVMLGVIFMIQGRHVK
MPVKELGKVIGTGMLIGLHWILFFGAARVSTASVCLAGVATCSLWTAFIEPWVNHSKIKW
YEVMLGIMVLVGLYVIFRFEVQHWKGLAMAIGAAFLGACFTVSNGQLTKKHAAYVITFYE
MIGACLFSLLFMPIYVQFWAGEEGLQLVPAPMDWFWLLLLGGVCTVYAFSVSVELMRRLS
VFVINLTVNLEPVYGIILAVLIFGDQEKMTPGFYMGTLIILASVIMYPVFNFLYRRKKNK
QLLRMQ