Protein Info for Echvi_2050 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details PF03739: LptF_LptG" amino acids 8 to 354 (347 residues), 258.3 bits, see alignment E=5.7e-81

Best Hits

KEGG orthology group: None (inferred from 52% identity to mtt:Ftrac_0313)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYC1 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Echvi_2050 Predicted permeases (Echinicola vietnamensis KMM 6221, DSM 17526)
MIKLLDKLIIKDFLKTYFFVVLMLILIVLVLDFTEKNDDFIRNNVPTPEILKYMFNYGLY
LNNLLTPITVFISVIFITSRMAGRTEIVAILSSGVSFVRMLRPFLIGASMIAIASFLLNG
WVLPGATAGVYNFKMEYLEDDAQYNYQNLHVKVAPDVYAYISKYYTGPKTGYTFTLEHIE
DGKLISKLSADRIVWDTAANAWEVRNYKIRTLEDMEEAYEVGEEMDTVLSITPADFDLPP
NHHETLNLPELSRQIKVLEDRGADNVNFYKIERYVRFMSPFAAIILTFIGVIVASKKTRG
GSGFKIALGFLLAFVYIILFLLSRTFAEAGTPYPILAVWSPNIIFAITGLVMYKTIPR