Protein Info for Echvi_2039 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: FOG: WD40-like repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00149: Metallophos" amino acids 21 to 198 (178 residues), 58.1 bits, see alignment E=3.6e-19 PF13360: PQQ_2" amino acids 283 to 361 (79 residues), 39 bits, see alignment E=1.5e-13 amino acids 332 to 445 (114 residues), 69.4 bits, see alignment E=7.5e-23 amino acids 477 to 606 (130 residues), 40.2 bits, see alignment E=6.5e-14 PF01011: PQQ" amino acids 442 to 497 (56 residues), 28.2 bits, see alignment 1.7e-10

Best Hits

KEGG orthology group: None (inferred from 61% identity to phe:Phep_1593)

Predicted SEED Role

"Pyrrolo-quinoline quinone"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZV1 at UniProt or InterPro

Protein Sequence (611 amino acids)

>Echvi_2039 FOG: WD40-like repeat (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKLLALLLVMQIGGVYGQNFKFAFVTDTHIGSPSGAAEEDLEKTITDINGQEGLDFVLL
TGDITEMGTDEEIARAKEIIDKLKIPYYVIPGNHDTGWSESGGVSFIKAFGYDKFVFEHE
GYKFIGTASGPYVRMSDGHIPRDAVVWMDSVLAATPKDQRIINVNHYPLDNSLDNWFELT
ERLKKYNTQFSICGHGHRNKPYDFEGIPGAMGRSNLRAKDAVGGYNIVTISPDTAYFAER
TSGLKTDAPWRKIALGAKDYAAKENYERPDFSINEKYDQVSAKWSYHADANVISTPLVAK
GKVIFGNSVGKVEALSIETGRLEWSYDTGAGIFSSPVRYHDLVIFGTGDGNIYALNLTDG
ELEWKTPASAAVLGSPIVEDGKVYIGASDGKFRALDAKDGKVLWVFGGLEGPVVSKPLIY
QGKVIFGAWDRHLYAVDRASGKLAWKWDNGSANRMYSPAMCVPVAHEGVVYIVAPDRYIT
ALDAASGEELWRSNEATVRESIGISSDGKWVYGKTMNDEVVAFETGRDAANLAWRMDCGF
GYEHVPSMLIENGGAVYFGTKNSTVYSIDPQTRTIHWAHKIDNSMANTVNVIDEHSLVVA
TMDGKVELLEF