Protein Info for Echvi_2037 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycosyl hydrolase family 9./N-terminal ig-like domain of cellulase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 450 to 471 (22 residues), see Phobius details PF02927: CelD_N" amino acids 27 to 103 (77 residues), 53.5 bits, see alignment E=3.4e-18 PF00759: Glyco_hydro_9" amino acids 118 to 587 (470 residues), 257.4 bits, see alignment E=3.4e-80

Best Hits

KEGG orthology group: None (inferred from 68% identity to lby:Lbys_2672)

Predicted SEED Role

"FIG01093606: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWK0 at UniProt or InterPro

Protein Sequence (594 amino acids)

>Echvi_2037 Glycosyl hydrolase family 9./N-terminal ig-like domain of cellulase. (Echinicola vietnamensis KMM 6221, DSM 17526)
MLTILISLLSFVGHSAAPSTSADTVYFRVNQLGYLPEDTKSAVVFGKETLHEPVQLIDAK
SAEAVTEIKPQKDMAEGWGDFTYATVDFSSTTRVGDYYLQTKHSKIRSQPFSIGEDVYSH
HQETLLEFMRQQRCGYNPTLDMVCHQRDGRAFFGPMPDSTFVEVSGGWHDAGDQLKYLIT
SSYATAHMLLAYEMYPDRFQDKVNALGQDGPNGIPDILDEAKWGLDWILKMHPAPDQLFH
QVADDRDHKGYKIPDQDNSDYGWGANSYRPVYFATGKPQGLQQYKSEATGVANLAGRCAA
ALALAARIWAEDLNDTVLAATYRKASQSLYALGRKQEGYQQGNSYSAPYRYNESTWADDM
EWGAAELFKTTGEKEYLVQAKAYALKSNTADSWTVVDSTDHYRLYPFINMGHFVLHDLVD
DDFKKKLEGYYQAGIEYTLKRASKNPFQVGVPFIWCSNNLMTGLITQMILYEKMSGSKRY
KGYLARQRDWLFGRNPWGTSMFTGLPVNGESPEAVHTSLFVLLGLKIPGGLVDGPVYTAI
YDNLLGLHLQEPDEFAEFQNEKVVYHDDSGDYSTNEPTMDGTAGAILMMTHWAK