Protein Info for Echvi_2024 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Na+/proline symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 116 to 144 (29 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 233 to 250 (18 residues), see Phobius details amino acids 271 to 296 (26 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 396 to 416 (21 residues), see Phobius details amino acids 428 to 449 (22 residues), see Phobius details amino acids 456 to 475 (20 residues), see Phobius details PF00474: SSF" amino acids 33 to 416 (384 residues), 89.6 bits, see alignment E=1.1e-29

Best Hits

KEGG orthology group: None (inferred from 69% identity to cly:Celly_0750)

Predicted SEED Role

"sodium/iodide co-transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY97 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Echvi_2024 Na+/proline symporter (Echinicola vietnamensis KMM 6221, DSM 17526)
MSQTLVFIVISSYFLLLLLISYLTSRKTDDLTFYTANRQSPWYLVAFGMVGASLSGVTFI
SVPGEVGNSSWNYLQFVMGNMVGYAVIAMVLIPLFYRLNLISIYEYLRDRFGQKAYLSGA
VIFLVSQTIGASFRLFLAATVLQIAFFDAYNIPFFVTVLTTATLIWIYTYKGGIKTIVWT
DTLQTTFLLLAVIISIVIISQQLDLSLGELTSVIHQSPLSTVFEWDPLSNKNFFKMFFAG
IFITITMNGLDQNVMQKNLTCKDQKEAKKNILWFSISFFISNLFFLSLGVLLYYFAAQNN
IAIPTSSDELYPILALDHFGTLAGITFLLGIIAAAFSSADSALTALTTSFCVDIMKLPTK
RHLNQRATRLKVHIGFTALIFVVIVLFDLLNNSSVVSAVFKAAGFTYGPLLGLFAFGLTN
KIAVKDKLVPAICLASPVICYILDSHSAAWFGGYQFGFEILLVNGALTYLGLLLAMKK