Protein Info for Echvi_2019 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF00085: Thioredoxin" amino acids 5 to 103 (99 residues), 117.5 bits, see alignment E=2.6e-38 TIGR01068: thioredoxin" amino acids 8 to 104 (97 residues), 133.4 bits, see alignment E=1.4e-43 PF13098: Thioredoxin_2" amino acids 10 to 104 (95 residues), 45.9 bits, see alignment E=6.8e-16

Best Hits

Swiss-Prot: 59% identical to THIO2_CHLTE: Thioredoxin 2 (trx2) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

KEGG orthology group: K03671, thioredoxin 1 (inferred from 79% identity to mtt:Ftrac_1536)

MetaCyc: 55% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY93 at UniProt or InterPro

Protein Sequence (106 amino acids)

>Echvi_2019 thioredoxin (Echinicola vietnamensis KMM 6221, DSM 17526)
MAKAIEITDANFEEIIKSDQPILVDFWAEWCGPCKMIGPVVEEIAGEYDGKAVIGKVDVD
ANPAVASKFGIRSIPTLLFFKNGEVVDKQVGAVPKSVLAQKLEAQI