Protein Info for Echvi_1989 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Na+/proline symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 72 to 95 (24 residues), see Phobius details amino acids 120 to 146 (27 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 234 to 251 (18 residues), see Phobius details amino acids 272 to 295 (24 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 374 to 392 (19 residues), see Phobius details amino acids 398 to 418 (21 residues), see Phobius details amino acids 430 to 447 (18 residues), see Phobius details amino acids 456 to 477 (22 residues), see Phobius details PF00474: SSF" amino acids 33 to 425 (393 residues), 78 bits, see alignment E=3.4e-26

Best Hits

KEGG orthology group: None (inferred from 59% identity to sli:Slin_1598)

Predicted SEED Role

"sodium/iodide co-transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY67 at UniProt or InterPro

Protein Sequence (489 amino acids)

>Echvi_1989 Na+/proline symporter (Echinicola vietnamensis KMM 6221, DSM 17526)
MDSNLILLVITSYFLLLFIISYFTSRKVSQETFFTGDRQSPWFLVAFGMIGASLSGVTFI
SVPGEVGGSNFYYFQVVLGYTVGYLTIAKVLLPLYYRMNLVSIYAYLEDRFGFWSYKTGA
FFFILSRTLGSSIRVFLVAGVLQLILFDDWGIPFWVSVLITVSLIWLYTHRGGIKTVVWT
DTLQTLFMLLAVGTSIYLVGKDLGIAGAGDLVGRVMADSRSEIFNWDWQAGTNFFKQFAS
GAFITIVMTGLDQDMMQKNLTCRNIGDAQKNMFWFTIILVFVNLCFLVLGVLLYQYCEVN
QISLPARTDDLYPMLATEHFSVFAGTVFVLGIIAAAYSSADSTLTALTTSFCFDFLEIER
KYPKERQQSIRKKVHLAFTGIMFFVILLFRWINDQSVINTVFVIAGYTYGPLLGLYSFGL
FTKRAVKDKMVPWIAAMAPLIAYVISLNSKKWLWGYEFGFEVLILNGGLMFLGLMIFSNK
QETGRALGD