Protein Info for Echvi_1987 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: recombination protein RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF14520: HHH_5" amino acids 5 to 33 (29 residues), 20.9 bits, see alignment 1.3e-07 amino acids 14 to 47 (34 residues), 18.4 bits, see alignment 7.3e-07 TIGR00615: recombination protein RecR" amino acids 6 to 200 (195 residues), 234.9 bits, see alignment E=2.7e-74 PF21176: RecR_HhH" amino acids 8 to 50 (43 residues), 50.5 bits, see alignment 4.3e-17 PF02132: RecR_ZnF" amino acids 57 to 75 (19 residues), 30.7 bits, see alignment (E = 6.4e-11) PF13662: Toprim_4" amino acids 82 to 176 (95 residues), 92 bits, see alignment E=6.7e-30 PF01751: Toprim" amino acids 83 to 172 (90 residues), 27.7 bits, see alignment E=7.5e-10 PF21175: RecR_C" amino acids 178 to 200 (23 residues), 40.2 bits, see alignment (E = 5.2e-14)

Best Hits

Swiss-Prot: 60% identical to RECR_AMOA5: Recombination protein RecR (recR) from Amoebophilus asiaticus (strain 5a2)

KEGG orthology group: K06187, recombination protein RecR (inferred from 66% identity to sli:Slin_1600)

MetaCyc: 40% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G035 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Echvi_1987 recombination protein RecR (Echinicola vietnamensis KMM 6221, DSM 17526)
MNFPSKLIEDAVNEISRLPGIGKKTALRLALHLLKQPEAIAENLTDAITKLRKETAYCRV
CHNISDQEICSVCQSPRRDRSLICVVEDIPDVLAIENTSQYNGLYHVLGGVISPIQGIGP
EELKIASLLTRIDQPHSGEAVSEVILALPSTMEGDTTAFYITRKLKEKGIKVSTIARGIP
IGGELEYTDEVTLGRSILTRVNYSVD