Protein Info for Echvi_1947 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Bacteroides conjugation system ATPase, TraG family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 821 transmembrane" amino acids 633 to 650 (18 residues), see Phobius details PF12991: DUF3875" amino acids 8 to 54 (47 residues), 59.9 bits, see alignment 2.7e-20 TIGR03783: Bacteroides conjugation system ATPase, TraG family" amino acids 9 to 819 (811 residues), 1109 bits, see alignment E=0 PF11130: TraC_F_IV" amino acids 258 to 370 (113 residues), 30.6 bits, see alignment E=3e-11 PF19044: P-loop_TraG" amino acids 407 to 819 (413 residues), 752.8 bits, see alignment E=1.2e-230

Best Hits

KEGG orthology group: None (inferred from 65% identity to zpr:ZPR_3458)

Predicted SEED Role

"Conjugative transposon protein TraG" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZM0 at UniProt or InterPro

Protein Sequence (821 amino acids)

>Echvi_1947 Bacteroides conjugation system ATPase, TraG family (Echinicola vietnamensis KMM 6221, DSM 17526)
MIFNTPHIDLKDNFPLYKVEKDRILSREGDITAAFGLQLPEIFTLSAEDYLALHHTWTKA
IGVLPVNCVFHKQDWFTRASHQANFAPGQSFLSRSSEGFFHERPYLDHRCHLYITRRPLD
KPLGNSAVSNLLRTSLVPTESISEKAWEHFEDALGQFCQILEDGGTELVPISGEEICGSA
HRSGVLENYLFLKDAARPELMDIRFKPEWKIGDKYVLMYSMADVEDLPGSVSPDARLERY
ATDKSDFRSGFAAPIGAMLPCNHIYNQYLFIEDHQKTLKRLESKRLRLESLAAYSRENAL
SKEATSAFLNEAISEGRKAVKAHFNLMLWTEQKEGLTELRNKASAALAKMDVTPRQETVG
APQLFWAGLPGNQGAFPSNEAFDTFIGPASCFLNLETNYRSSISPVGIRLGDRITGHPVH
VDISDEPLRKGYITNRNKFILGPSGSGKSFFTNHMVRHYYEQGTHVVLVDVGHSYRGLCD
LVEGYYFTYEENNPIRFNPFVTADGNPPDTEKKESLKTLLLALWKKDDEPFKRSEYVALS
NALTGYYEYLQQSPGEVPGFNSFYEYLEVEFREVLQRDGVKDKDFDIENFMYVLRPYYQG
GEFDYLLNATENLDLLHQRFIVFELDNIKDHPILFPVVTIIIMEIFIAKMRKLKGVRKMI
LIEEAWKAIAKEGMAEYIKFLFKTVRKFFGEAIVVTQEVEDIISSPVVKEAIINNSDCKI
LLDQSKYQNKFERIQELLGLTEKEKAQALSINKANEPGRLYKEVFISLGGQYSRVYRTEV
SKAEYLAYTTEESERMQIDTLTRKYGGDRKKAIAVLSREKP