Protein Info for Echvi_1923 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF12771: SusD-like_2" amino acids 31 to 446 (416 residues), 451.3 bits, see alignment E=3.4e-139 PF12741: SusD-like" amino acids 71 to 386 (316 residues), 113.9 bits, see alignment E=1.1e-36 amino acids 391 to 476 (86 residues), 49.2 bits, see alignment E=4.2e-17

Best Hits

KEGG orthology group: None (inferred from 57% identity to cly:Celly_2998)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYR1 at UniProt or InterPro

Protein Sequence (479 amino acids)

>Echvi_1923 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKYIYALLVASTALWATGCSKDFEATNTDPNNLSKITAGSTLNPVLYSLASQNAKQMRS
VTAPLMQMFLQTDDFNNSPFFYDFDQNIGASTWNNYYTNLSNIAEMEKAAVRDGLPNYEA
IALTLKAYAYSVLTDCFGDVPMADALQAEEDVWYPAFSAQEDIYNQLLEDLEYANSIYDE
EQGMPYVSDILYGNDVQKWRKFTNSLHLRLLLRVSNRPETGAFDKITEMINAPETYPVFA
SGDDGAVLHLDGVAPTLSPWDRPQDFGVFRYYTEFFIDNLNNFQDPRIGVFAGTAKGLEG
EDYGYIGQPTDFVENPLPDSIATASGVQRSLAEAPLIIPIMSYAEVEFIKAEMAQRGYID
DAQLHYENGVKAAIEMWSQEVPEGYFDNPAAAYDGSLDRILLQKYYDLFFTDYQAWFEQR
RTGLPELPTSASMLNDGEMPARFYYPIDEANSNFQNYQEAVNRMGGDEINVKVWWDNEN