Protein Info for Echvi_1913 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: nitrite extrusion protein (nitrite facilitator)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details amino acids 277 to 294 (18 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details TIGR00886: nitrite transporter" amino acids 22 to 386 (365 residues), 312.4 bits, see alignment E=2.2e-97 PF07690: MFS_1" amino acids 28 to 389 (362 residues), 111.4 bits, see alignment E=2.3e-36

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 65% identity to csa:Csal_1131)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYQ0 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Echvi_1913 nitrite extrusion protein (nitrite facilitator) (Echinicola vietnamensis KMM 6221, DSM 17526)
MKQAIKKATSIRLLDFKSRQMRAFHLSWFAFFLCFFGWFGIAPLMTVVRDELDLTKSQIG
NIIIASVSITVIARLMIGWLVDRIGPRITYTYLLILGSIPVMLIGLSNSYESFLLFRLAI
GVIGSSFVITQYHTSVMFAPNCVGTANATSAGWGNMGGGVTQMVMPLIFAFFVSLGYLDA
QAWRYAMVVPGIAMILTGIAYYKWTTDFPEGNISDLSKADLEYKKKKKADGQGAFKAAIS
DHRVWALFLIYGACFGIELTINNIAAIYYHDFFQLDLKTAGLIAGLFGVMNLFARSVGGM
FGDKAGIKWGLKGRVGFLGAVLLVEGLALTLFAQMTVLPLAIGTMILFSLFVQMAEGATF
SVVPFINKKAIGTISGIVGAGGNAGAVMAGFLFKMEGISYGEALTVLGIAVTAISASSLL
VRFSAEDEKAAKTEMDASLSEKELQPEYVKS