Protein Info for Echvi_1894 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: molybdenum cofactor biosynthesis protein A, bacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 2 to 325 (324 residues), 341.7 bits, see alignment E=2e-106 PF04055: Radical_SAM" amino acids 17 to 175 (159 residues), 96.8 bits, see alignment E=1.6e-31 PF06463: Mob_synth_C" amino acids 182 to 306 (125 residues), 95.9 bits, see alignment E=1.8e-31

Best Hits

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 57% identity to cly:Celly_2802)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW73 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Echvi_1894 molybdenum cofactor biosynthesis protein A, bacterial (Echinicola vietnamensis KMM 6221, DSM 17526)
MLIDNHGRTINYLRLAVTDNCNLRCQYCMPEEGVQFAHKKELLSWDELWLLSQTFVAMGV
DKIRITGGEPFVRKGLMDFLEKLSGLEGLEEISITTNATLIGPHILHLKQLGITKINISF
DSLDKARFNEITRRDQYDTVMANIQRMMEEGFDVKLNCVIMDGKNTEDIIPFVKYVQDHP
ISVRFLEEMPFNGQTSEPVSLKWDYIAILEHIKEHFGPIQKLPAPASSTSLNYQREGSKG
TFGVIPSYSRTFCGTCNRVRVTAKGEMQTCLYSTETIDLRALLRESNHINGLKFSIFTAM
QARHKDGFEAENQSETKKSMTLIGG