Protein Info for Echvi_1883 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: C-terminal peptidase (prc)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 69 to 371 (303 residues), 288.7 bits, see alignment E=2.7e-90 PF00595: PDZ" amino acids 114 to 184 (71 residues), 28.3 bits, see alignment E=3.7e-10 PF13180: PDZ_2" amino acids 117 to 193 (77 residues), 34.8 bits, see alignment E=3.4e-12 PF17820: PDZ_6" amino acids 130 to 186 (57 residues), 38.5 bits, see alignment 1.6e-13 PF03572: Peptidase_S41" amino acids 216 to 371 (156 residues), 170.6 bits, see alignment E=4.4e-54

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 57% identity to mtt:Ftrac_0006)

Predicted SEED Role

"Carboxy-terminal processing protease"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYM3 at UniProt or InterPro

Protein Sequence (559 amino acids)

>Echvi_1883 C-terminal peptidase (prc) (Echinicola vietnamensis KMM 6221, DSM 17526)
MSEEKNTSQPDVKPSKNTKSQIRLPIILALAISAGIWIGATFAEPKTDQNDLKAALYKLQ
EIITYIDRDYVDTVNTTKLVEHGIEKMLEELDPHSSYIPAEDAQLAQSQLDGEFDGIGVE
FGILRDTIYVVAPLTGGPSEKLGIQSGDQIIKVDGETVAGTGVTNRDVFDLLRGPKGSVV
NVGIKRKNHKELIDYAITRDKIPQYSINASYMINDDTGYIKITRFAATTYDEFKEAVEKL
KAEGMSKLVLDLQGNPGGYMGAAINIADEILADNAMIVSQQGKVSRYNQKAFAMRPGEFE
DGSVVVLINEGSASASEIVAGALQDNDRALIVGRRSFGKGLVQMPIDLSDGAELRLTIAR
YYTPSGRSIQKPYGDDQNEYNMDWINRYEHGEFFSADSIHFNDSLKYQTVKGRTVYGGGG
IMPDYFVPMDTTMSSSYVGRLFSSDSHREFIMDYLEDNKSQFENMSFEEYYNDFTFSDKS
LKKLIAIGDKNKVKFDEKDYEKSKAYLKILLKAHMGRNIYDDNAFYKVINDINEIYQQGI
KLFEEAEQLAFSSETATTE