Protein Info for Echvi_1848 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): periplasmic glucoside 3-dehydrogenase (lacC subunit) (EC 1.1.99.13)
Rationale: Important for utilization of various glucosides (trehalose, salicin, cellobiose, and perhaps lactose). Related to lacC of Caulobacter crescentus which is a component of lactose 3-dehydrogenase.
Original annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13618: Gluconate_2-dh3" amino acids 43 to 166 (124 residues), 132.1 bits, see alignment E=8.9e-43

Best Hits

KEGG orthology group: None (inferred from 47% identity to shg:Sph21_3640)

Predicted SEED Role

"FIG01111510: hypothetical protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.13

Use Curated BLAST to search for 1.1.99.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXU4 at UniProt or InterPro

Protein Sequence (183 amino acids)

>Echvi_1848 periplasmic glucoside 3-dehydrogenase (lacC subunit) (EC 1.1.99.13) (Echinicola vietnamensis KMM 6221, DSM 17526)
MAMNRRDALKSFALMMGGTMVGANALLTGCTPDKQIEGLDFSPEEIDFLDEIGDTIIPTT
DTPGAKAVGIGSFMVMMVKDTYWEEEQKQFIDGLNSLRKGFKEEVGKDFMDASQEERTAY
LNKLNAAAREENGPKYFNMLKDLTVLGYFTSEIGATQALNYVEVPGKWEPCIDYKKGDKA
HAI