Protein Info for Echvi_1846 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): 3-keto-beta-glycoside 1,2-lyase
Rationale: Specifically important in carbon source D-Salicin. In a conserved cluster with the 3-ketoglycoside pathway starting with lacAC. Distantly related to BT2156, which is a 3-keto-beta-glucoside lyase (PMID:38898276).
Original annotation: Hydroxypyruvate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF01261: AP_endonuc_2" amino acids 90 to 270 (181 residues), 79.7 bits, see alignment E=1.5e-26

Best Hits

KEGG orthology group: K01816, hydroxypyruvate isomerase [EC: 5.3.1.22] (inferred from 67% identity to fbc:FB2170_15851)

Predicted SEED Role

"Hydroxypyruvate isomerase (EC 5.3.1.22)" (EC 5.3.1.22)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.22

Use Curated BLAST to search for 5.3.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZR0 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Echvi_1846 3-keto-beta-glycoside 1,2-lyase (Echinicola vietnamensis KMM 6221, DSM 17526)
MMVGSAVLSGLPYLNLKAKNKEMLKGNINHSVCRWTYGHLSLDELCVLIKDIGFNAIDLL
GPDDWPTAQKYGVYSSMCNGAEISLEEGFSHSEYHDTLIKNYTEMIPLVAKNGYKNLICF
SGNRNGMDDETGLQNSVKGLQKLLPLAEKHGVTLTMELLNSKVDHPDYMCDKSVWGVELC
KRLDSEHFNLLYDIYHMQIDEGDVIRTIGENHQYYGHYHTAGNPGRNEIDDTQELNYPAI
IKAIAKTGFKGYIAQEFIPKADDKAASLREAIALCDI