Protein Info for Echvi_1845 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): 2-hydroxy-3-keto-glucal transporter
Rationale: Specifically important in carbon source D-Salicin; carbon source D-Trehalose dihydrate. In a conserved cluster with the 3-ketoglycoside pathway starting with lacAC. The 3-ketoglycoside is probably cleaved in the periplasm by Echvi_2921 or Echvi_1840, yielding 2-hydroxy-3-keto-glucal. Hydration of the product to 3-ketoglucose appears to occur in the cytoplasm (Echvi_1842), so this is probably a 2-hydroxy-3-keto-glucal transporter.
Original annotation: Nucleoside H+ symporter.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 381 to 400 (20 residues), see Phobius details PF03825: Nuc_H_symport" amino acids 4 to 404 (401 residues), 384.7 bits, see alignment E=1.1e-118 PF12832: MFS_1_like" amino acids 8 to 370 (363 residues), 110.7 bits, see alignment E=1.7e-35 PF01306: LacY_symp" amino acids 8 to 405 (398 residues), 31.9 bits, see alignment E=1.3e-11 PF07690: MFS_1" amino acids 9 to 249 (241 residues), 35.1 bits, see alignment E=1.5e-12 amino acids 263 to 407 (145 residues), 46.8 bits, see alignment E=4.1e-16

Best Hits

KEGG orthology group: None (inferred from 70% identity to psn:Pedsa_3793)

Predicted SEED Role

"Putative nucleoside transporter yegT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW39 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Echvi_1845 2-hydroxy-3-keto-glucal transporter (Echinicola vietnamensis KMM 6221, DSM 17526)
MSFNTKFKLSFMMFLEFFIWGGWFVTLGLFLGNNLGTNGAQDAAVFSTQSLGAIIAPFII
GLIADKYFNAERILGILHLIGAVLMYLMYTATDFESFYPYVFAYMVAYMPTLALVNSVSF
NQMSNPEKEFGVIRVWGTIGWIVAGLVISLVFAWDSTENAAAGMLKYTFLMTCIASLVLG
VYSFMLPKTPPKIAKGEKKSISEILGLDAFTLLKDRNYLVFFLSSVLICIPLAFYYQNAS
KFFGEIGMTNLTSKMALGQGSEVLFMLLLPIFFGKFGVKKTLLVGMLAWVVRYALFAFGN
VGELSFMLLTGIALHGICYDFFFVSGQIYTDSKAGEKFKSAAQGMITLATYGVGMLIGFW
VAGWAYDTYEMSDKVHDWKTIWLIPSGIAVLVALIFAVAFKQKKTTPVEA