Protein Info for Echvi_1842 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): 3-ketohexose dehydratase
Rationale: Important for utilizing various glycosides (salicin, trehalose, cellobiose, and lactose). In a conserved cluster with the 3-ketoglycoside pathway starting with lacAC. 67% identical to the Agrobacterium enzyme (AtHyd, PMC10628242). The role in beta-lactose utilization suggests that it is a 3-ketogalactose dehydratase as well as a 3-ketoglucose dehydratase..
Original annotation: Sugar phosphate isomerases/epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF01261: AP_endonuc_2" amino acids 29 to 321 (293 residues), 128.6 bits, see alignment E=1.7e-41

Best Hits

KEGG orthology group: None (inferred from 74% identity to cpi:Cpin_7279)

Predicted SEED Role

"Inosose isomerase (EC 5.3.99.-)" in subsystem Inositol catabolism (EC 5.3.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.99.-

Use Curated BLAST to search for 5.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZD3 at UniProt or InterPro

Protein Sequence (350 amino acids)

>Echvi_1842 3-ketohexose dehydratase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKTIKGPALFLAQFADDQAPFNSLKSICEWAASIGYKAVQIPSWDGRFMDLKKAAEEPEY
ANEIKQTVADAGLEISELSTHLQGQLVAVNPAYNELFDAFAPEELKGDLEGKTKWATQQL
MYAAKASKNLGLTKHGTFSGALMWHTVYPWPQRPAGLVEAGFEELAKRWLPILDEFDKNG
VDLCYELHPGEDLHDGVTFEMFLEKVNQHPRANILYDPSHFVLQCLDYVQFIDFYKDRIK
MFHVKDAEFNPTGKQGVYGGYQGWIDRAGRFRSLGDGQVDFNAIFSKLSQYGFDGWAVLE
WECAIKHPEAGAIEGAKFISEKIIRVTEKTFDDFASAGTDDALNKKVLGI