Protein Info for Echvi_1841 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): predicted cytochrome c component of periplasmic glycoside 3-dehydrogenase (EC 1.1.99.13)
Rationale: Important for utilizing various glucosides (salicin, trehalose, cellobiose, and perhaps lactose). In a conserved cluster with the 3-ketoglycoside pathway starting with lacAC.
Original annotation: Cytochrome c551/c552

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00034: Cytochrom_C" amino acids 59 to 139 (81 residues), 34 bits, see alignment E=3.2e-12

Best Hits

Predicted SEED Role

"Cytochrome c551/c552" in subsystem Soluble cytochromes and functionally related electron carriers

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.13

Use Curated BLAST to search for 1.1.99.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZQ4 at UniProt or InterPro

Protein Sequence (141 amino acids)

>Echvi_1841 predicted cytochrome c component of periplasmic glycoside 3-dehydrogenase (EC 1.1.99.13) (Echinicola vietnamensis KMM 6221, DSM 17526)
MNLSKLASAGAIALAGMAYACGGGSDTKSEETTSAAESAAPKKEMSFDEMYKDNPDYVEG
LALVKESDCPSCHMVERKIVGPAYKDVAEKYESTDENIETLAKRVVDGNNGVWGQVPMPA
HPGLSEDDAKKMVKYILMLKK