Protein Info for Echvi_1834 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ribosome small subunit-dependent GTPase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF16745: RsgA_N" amino acids 4 to 59 (56 residues), 52.2 bits, see alignment E=1e-17 TIGR00157: ribosome small subunit-dependent GTPase A" amino acids 45 to 302 (258 residues), 231.8 bits, see alignment E=4.6e-73 PF03193: RsgA_GTPase" amino acids 65 to 244 (180 residues), 182 bits, see alignment E=2.3e-57 PF01926: MMR_HSR1" amino acids 181 to 245 (65 residues), 26.6 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 53% identical to RSGA_CYTH3: Small ribosomal subunit biogenesis GTPase RsgA (rsgA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K06949, ribosome biogenesis GTPase [EC: 3.6.1.-] (inferred from 53% identity to chu:CHU_2727)

Predicted SEED Role

"Ribosome small subunit-stimulated GTPase EngC" in subsystem Universal GTPases

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYI7 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Echvi_1834 ribosome small subunit-dependent GTPase A (Echinicola vietnamensis KMM 6221, DSM 17526)
MEQKGRVIKSTGSWYEVETEKGPIRARLRGKFKQDDLKLTNPIAVGDFVLLAKEINQESA
VISSILPRENYIIRKSTRKQNFSHILASNIDQAFLVVTLKQPRTSLGFIDRFIVSTESFR
IPTTIVVNKMDLVKKEKDKEFLQDIHDIYEPLGYPVVEISALDDEGLQEVFLPKLSGKTT
LLSGHSGVGKSSLLNKIIPSASQTTKEVSSFTSKGVHTTTFAEMFPLEGGGYLIDTPGIK
EFGILDIDDQELSHYFVEMRKYLGQCKYNNCKHLNEPGCKVLEVLEEGYIHPYRYDSYVK
ILHEEDTFR