Protein Info for Echvi_1833 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 3-deoxy-D-manno-octulosonic-acid transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K02527, 3-deoxy-D-manno-octulosonic-acid transferase [EC: 2.-.-.-] (inferred from 43% identity to chu:CHU_2726)

Predicted SEED Role

"3-deoxy-D-manno-octulosonic-acid transferase (EC 2.-.-.-)" in subsystem KDO2-Lipid A biosynthesis or LOS core oligosaccharide biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.-.-.-)

MetaCyc Pathways

superpathway of (Kdo)₂-lipid A biosynthesis (13/17 steps found)
Kdo transfer to lipid IV_A (E. coli) (2/2 steps found)
Kdo transfer to lipid IV_A (Haemophilus) (1/2 steps found)
Kdo transfer to lipid IV_A (Chlamydia) (2/5 steps found)
superpathway of Kdo₂-lipid A biosynthesis (13/25 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXS9 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Echvi_1833 3-deoxy-D-manno-octulosonic-acid transferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MSQKTAIDVRSFTGFLLFLGMKVLYDFSVWVFSGMLRMASGGDSKLARLVRGRKPVFDEI
AIFREKHHGKVAWFHVASLGEYEQAKPVIARLKQEFPAMAVLVTFFSPSGYENVIKKPQP
NVDGVTYLPFDTEGNAKHFLNLVKPSVVFFVKYDLWANFIFEAKKRQVPLFLFSAALRKD
QVYFQFYGGFFRKVLKCFDHIYVQNDQTQRLLGEIGVSETTVTGDTRYDNVRAISQSPKQ
FPEIEALFGQKKVMVIGSAWPEDMEVILPFVNSHEDFHYIIAPHDINDAQIADWQLQIKH
PSIKYSELDGASSEGVKVLFIDNIGMLSSLYQYAKVAYVGGAFGKGLHNILEPLAFYIPV
LFGKLKKASKFPEGGISQQYGCGFEVEDAAAFEKIILALEAPEAYDQAVNAAEKLVMDNL
GSAANIINSVKNTVQWSKKEG