Protein Info for Echvi_1822 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ubiquinone/menaquinone biosynthesis methyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 11 to 240 (230 residues), 228.8 bits, E=3.6e-71
• TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase
  • amino acids 17 to 240 (224 residues), 267.5 bits, E=3.7e-84
• PF12147: Methyltransf_20
  • amino acids 45 to 154 (110 residues), 28.6 bits, E=4.9e-10
• PF02353: CMAS
  • amino acids 45 to 190 (146 residues), 31.2 bits, E=8.6e-11
• PF06325: PrmA
  • amino acids 47 to 155 (109 residues), 26.3 bits, E=3.1e-09
• PF01135: PCMT
  • amino acids 47 to 158 (112 residues), 24.2 bits, E=1.6e-08
• PF05175: MTS
  • amino acids 48 to 160 (113 residues), 24.7 bits, E=9.7e-09
• PF13489: Methyltransf_23
  • amino acids 49 to 221 (173 residues), 42.3 bits, E=4.1e-14
• PF13847: Methyltransf_31
  • amino acids 55 to 196 (142 residues), 64.5 bits, E=5.7e-21
• PF13649: Methyltransf_25
  • amino acids 59 to 154 (96 residues), 75.7 bits, E=2.3e-24
• PF08241: Methyltransf_11
  • amino acids 60 to 158 (99 residues), 72.9 bits, E=1.7e-23
• PF08242: Methyltransf_12
  • amino acids 60 to 155 (96 residues), 50.9 bits, E=1.3e-16

Best Hits

Swiss-Prot: 51% identical to MENG_BACFR: Demethylmenaquinone methyltransferase (menG) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 70% identity to mtt:Ftrac_2976)

MetaCyc: 39% identical to S-adenosylmethionine:2-demethylmenaquinol methyltransferase (Geobacillus stearothermophilus)
RXN-11046 [EC: 2.1.1.163]; 2.1.1.163 [EC: 2.1.1.163]

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-) @ 2-heptaprenyl-1,4-naphthoquinone methyltransferase (EC 2.1.1.163)" (EC 2.1.1.-, EC 2.1.1.163)

MetaCyc Pathways

• superpathway of menaquinol-8 biosynthesis I (9/10 steps found)
• superpathway of menaquinol-10 biosynthesis (8/10 steps found)
• superpathway of menaquinol-11 biosynthesis (8/10 steps found)
• superpathway of menaquinol-12 biosynthesis (8/10 steps found)
• superpathway of menaquinol-13 biosynthesis (8/10 steps found)
• superpathway of menaquinol-6 biosynthesis (8/10 steps found)
• superpathway of menaquinol-7 biosynthesis (8/10 steps found)
• superpathway of menaquinol-9 biosynthesis (8/10 steps found)
• menaquinol-10 biosynthesis (2/2 steps found)
• menaquinol-11 biosynthesis (2/2 steps found)
• menaquinol-12 biosynthesis (2/2 steps found)
• menaquinol-13 biosynthesis (2/2 steps found)
• menaquinol-7 biosynthesis (2/2 steps found)
• menaquinol-4 biosynthesis I (1/1 steps found)
• menaquinol-6 biosynthesis (1/1 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-9 biosynthesis (1/1 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
• superpathway of menaquinol-8 biosynthesis II (2/10 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163

Sequence Analysis Tools

See L0FZB6 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Echvi_1822 ubiquinone/menaquinone biosynthesis methyltransferases (Echinicola vietnamensis KMM 6221, DSM 17526)
MSVVPYKDQQDGKKAQVANMFNNISKRYDLLNHLLSLGIDITWRKKAIKMLQKDQPKVIL
DIATGTGDFAIEALALNPEKVIGVDISEGMLAEGKKKIKNKKLDHLIELQMGDSEKLLFE
ENKFDAVIVSFGVRNFENLEKGLADMHRVLKPGGKTVIVEFSKPKKFPFKQGYNFYFKYI
LPQIGKLVSKDQSAYTYLPESVQAFPDGDKFLAVLEKVGFKNTKCRPLTFGISSIYIGEK