Protein Info for Echvi_1822 in Echinicola vietnamensis KMM 6221, DSM 17526
Annotation: ubiquinone/menaquinone biosynthesis methyltransferases
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 51% identical to MENG_BACFR: Demethylmenaquinone methyltransferase (menG) from Bacteroides fragilis (strain YCH46)
KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 70% identity to mtt:Ftrac_2976)MetaCyc: 39% identical to S-adenosylmethionine:2-demethylmenaquinol methyltransferase (Geobacillus stearothermophilus)
RXN-11046 [EC: 2.1.1.163]; 2.1.1.163 [EC: 2.1.1.163]
Predicted SEED Role
"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-) @ 2-heptaprenyl-1,4-naphthoquinone methyltransferase (EC 2.1.1.163)" (EC 2.1.1.-, EC 2.1.1.163)
MetaCyc Pathways
- superpathway of menaquinol-8 biosynthesis I (9/10 steps found)
- superpathway of menaquinol-10 biosynthesis (8/10 steps found)
- superpathway of menaquinol-11 biosynthesis (8/10 steps found)
- superpathway of menaquinol-12 biosynthesis (8/10 steps found)
- superpathway of menaquinol-13 biosynthesis (8/10 steps found)
- superpathway of menaquinol-6 biosynthesis (8/10 steps found)
- superpathway of menaquinol-7 biosynthesis (8/10 steps found)
- superpathway of menaquinol-9 biosynthesis (8/10 steps found)
- menaquinol-10 biosynthesis (2/2 steps found)
- menaquinol-11 biosynthesis (2/2 steps found)
- menaquinol-12 biosynthesis (2/2 steps found)
- menaquinol-13 biosynthesis (2/2 steps found)
- menaquinol-7 biosynthesis (2/2 steps found)
- menaquinol-4 biosynthesis I (1/1 steps found)
- menaquinol-6 biosynthesis (1/1 steps found)
- menaquinol-8 biosynthesis (1/1 steps found)
- menaquinol-9 biosynthesis (1/1 steps found)
- superpathway of chorismate metabolism (42/59 steps found)
- superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
- superpathway of menaquinol-8 biosynthesis II (2/10 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.-
Use Curated BLAST to search for 2.1.1.- or 2.1.1.163
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0FZB6 at UniProt or InterPro
Protein Sequence (240 amino acids)
>Echvi_1822 ubiquinone/menaquinone biosynthesis methyltransferases (Echinicola vietnamensis KMM 6221, DSM 17526) MSVVPYKDQQDGKKAQVANMFNNISKRYDLLNHLLSLGIDITWRKKAIKMLQKDQPKVIL DIATGTGDFAIEALALNPEKVIGVDISEGMLAEGKKKIKNKKLDHLIELQMGDSEKLLFE ENKFDAVIVSFGVRNFENLEKGLADMHRVLKPGGKTVIVEFSKPKKFPFKQGYNFYFKYI LPQIGKLVSKDQSAYTYLPESVQAFPDGDKFLAVLEKVGFKNTKCRPLTFGISSIYIGEK