Protein Info for Echvi_1822 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ubiquinone/menaquinone biosynthesis methyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF01209: Ubie_methyltran" amino acids 11 to 240 (230 residues), 228.8 bits, see alignment E=3.3e-71 TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase" amino acids 17 to 240 (224 residues), 267.5 bits, see alignment E=3.7e-84 PF02353: CMAS" amino acids 45 to 190 (146 residues), 31.2 bits, see alignment E=7.8e-11 PF12147: Methyltransf_20" amino acids 45 to 154 (110 residues), 27.5 bits, see alignment E=9.9e-10 PF01135: PCMT" amino acids 47 to 158 (112 residues), 24.2 bits, see alignment E=1.4e-08 PF06325: PrmA" amino acids 47 to 155 (109 residues), 28.3 bits, see alignment E=7e-10 PF05175: MTS" amino acids 48 to 161 (114 residues), 24 bits, see alignment E=1.4e-08 PF13489: Methyltransf_23" amino acids 49 to 222 (174 residues), 41 bits, see alignment E=9.2e-14 PF13847: Methyltransf_31" amino acids 57 to 196 (140 residues), 65.3 bits, see alignment E=3.1e-21 PF13649: Methyltransf_25" amino acids 59 to 154 (96 residues), 75.5 bits, see alignment E=2.5e-24 PF08241: Methyltransf_11" amino acids 60 to 158 (99 residues), 72.9 bits, see alignment E=1.5e-23 PF08242: Methyltransf_12" amino acids 60 to 155 (96 residues), 50.9 bits, see alignment E=1.2e-16

Best Hits

Swiss-Prot: 51% identical to MENG_BACFR: Demethylmenaquinone methyltransferase (menG) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 70% identity to mtt:Ftrac_2976)

MetaCyc: 39% identical to S-adenosylmethionine:2-demethylmenaquinol methyltransferase (Geobacillus stearothermophilus)
RXN-11046 [EC: 2.1.1.163]; 2.1.1.163 [EC: 2.1.1.163]

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-) @ 2-heptaprenyl-1,4-naphthoquinone methyltransferase (EC 2.1.1.163)" (EC 2.1.1.-, EC 2.1.1.163)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZB6 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Echvi_1822 ubiquinone/menaquinone biosynthesis methyltransferases (Echinicola vietnamensis KMM 6221, DSM 17526)
MSVVPYKDQQDGKKAQVANMFNNISKRYDLLNHLLSLGIDITWRKKAIKMLQKDQPKVIL
DIATGTGDFAIEALALNPEKVIGVDISEGMLAEGKKKIKNKKLDHLIELQMGDSEKLLFE
ENKFDAVIVSFGVRNFENLEKGLADMHRVLKPGGKTVIVEFSKPKKFPFKQGYNFYFKYI
LPQIGKLVSKDQSAYTYLPESVQAFPDGDKFLAVLEKVGFKNTKCRPLTFGISSIYIGEK