Protein Info for Echvi_1810 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 3-dehydroquinate dehydratase, type II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 transmembrane" amino acids 117 to 137 (21 residues), see Phobius details PF01220: DHquinase_II" amino acids 2 to 136 (135 residues), 185.5 bits, see alignment E=2e-59 TIGR01088: 3-dehydroquinate dehydratase, type II" amino acids 2 to 138 (137 residues), 179.3 bits, see alignment E=1.5e-57

Best Hits

Swiss-Prot: 52% identical to AROQ_PROMT: 3-dehydroquinate dehydratase (aroQ) from Prochlorococcus marinus (strain NATL2A)

KEGG orthology group: K03786, 3-dehydroquinate dehydratase II [EC: 4.2.1.10] (inferred from 66% identity to cpi:Cpin_2345)

Predicted SEED Role

"3-dehydroquinate dehydratase II (EC 4.2.1.10)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 4.2.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW14 at UniProt or InterPro

Protein Sequence (139 amino acids)

>Echvi_1810 3-dehydroquinate dehydratase, type II (Echinicola vietnamensis KMM 6221, DSM 17526)
MKILIINGPNLNLLGKREPEIYGSKSFEDFFGELETTFSNISLSYYQSNVEGELVNKIHE
VGFTYDAILLNAGAYTHTSVAISDAIAGVTTPVMEIHISNIYKRETFRHKSIISKECIGM
IAGLGLKGYALGIQYFLEN