Protein Info for Echvi_1809 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF02899: Phage_int_SAM_1" amino acids 9 to 91 (83 residues), 59.4 bits, see alignment E=3.6e-20 TIGR02225: tyrosine recombinase XerD" amino acids 11 to 300 (290 residues), 345.1 bits, see alignment E=1.6e-107 PF00589: Phage_integrase" amino acids 116 to 287 (172 residues), 155.8 bits, see alignment E=1e-49

Best Hits

Swiss-Prot: 43% identical to XERD_LISIN: Tyrosine recombinase XerD (xerD) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 61% identity to chu:CHU_2702)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYG6 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Echvi_1809 tyrosine recombinase XerD (Echinicola vietnamensis KMM 6221, DSM 17526)
MADSWENHIKQFEYYLKIERSLSKNSISAYRRDMEKLSAFMKDAFPGITPLTTQLNHLRA
FVSELASLGISEYTQARVISGVKAFFKFMVYEDKLEEDPAILLEAPKLGRKLPDTLSYEE
IVKLLEGIKLGTPEGHRNRAMLEVLYSSGLRVSELVELKLGMVYSDIGFLRILGKGNKER
LVPVGKDALRYLKLYLDEVRNHQKIAPGHEEYVFLNRRGKKMTRVMVFIFIKKLVEEVGI
KKKVSPHTFRHSFATHLIEGGADLRAVQEMLGHESITTTEIYTHLDREYLRQVLTDFHPR
K