Protein Info for Echvi_1806 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: dihydroorotate dehydrogenase, subfamily 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR01036: dihydroorotate dehydrogenase (fumarate)" amino acids 6 to 344 (339 residues), 431.6 bits, see alignment E=9.1e-134 PF01180: DHO_dh" amino acids 52 to 344 (293 residues), 303.9 bits, see alignment E=5.6e-95

Best Hits

Swiss-Prot: 65% identical to PYRD_GRAFK: Dihydroorotate dehydrogenase (quinone) (pyrD) from Gramella forsetii (strain KT0803)

KEGG orthology group: K00226, dihydroorotate dehydrogenase (fumarate) [EC: 1.3.98.1] (inferred from 67% identity to mtt:Ftrac_1484)

Predicted SEED Role

"Dihydroorotate dehydrogenase (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.1 or 1.3.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZM7 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Echvi_1806 dihydroorotate dehydrogenase, subfamily 2 (Echinicola vietnamensis KMM 6221, DSM 17526)
MSVYKSLLKPFLFKKSAEEAHHFTFSMTKTTFNLPLLKGVLKTMYGYEHPSLEREVFGLK
FRNPVGLAAGFDKDAKLIDEMAMLGFGFIEIGTLTPKPQDGNPQPRLFRLPEDEALINRM
GFNNGGVDEAVKRLKKRTSKVLIGGNIGKNKVTPNEHAASDYLYCLDSLHSYVDYFVVNV
SSPNTPNLRDLQEKEPLKELLSVVKERNDQKDHPKPILLKIAPDLSDGQLDDIIEIVKET
QIDGVIATNTTIDRTALKTDPQQVEALGAGGVSGKVLGKRSTEVIRYLSEHSGKAFPIIG
VGGIFSAQDAIEKLEAGASLVQVYSGMIYEGPGLMKAIKKGLKEYYNK